PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01719.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 427aa    MW: 47184.5 Da    PI: 4.6923
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01719.1_g00004.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM153.87.8e-4861341129
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                              l+pGfrFhPtd elv +yLk+kv gkkl + ++i+e+diyk+eP+dLp k  +k+++ +w+fF++r+kkyatg r+nrat+ g+Wk
  Rsa1.0_01719.1_g00004.1   6 LAPGFRFHPTDVELVRYYLKRKVLGKKLLV-DAIAELDIYKFEPSDLPdKsYIKSGDLKWHFFCPREKKYATGVRANRATEFGFWK 90 
                              579************************999.89**************96347778888**************************** PP

                      NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                              +tgk+++vl+ +ge+vg  ktLv++ g++p+ge+tdWvmheyrle
  Rsa1.0_01719.1_g00004.1  91 TTGKERTVLC-NGEVVGKIKTLVYHVGKSPRGERTDWVMHEYRLE 134
                              **********.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.1E-573156IPR003441NAC domain
PROSITE profilePS5100552.6356156IPR003441NAC domain
PfamPF023658.7E-258133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 427 aa     Download sequence    Send to blast
MGKTELAPGF RFHPTDVELV RYYLKRKVLG KKLLVDAIAE LDIYKFEPSD LPDKSYIKSG  60
DLKWHFFCPR EKKYATGVRA NRATEFGFWK TTGKERTVLC NGEVVGKIKT LVYHVGKSPR  120
GERTDWVMHE YRLEDNVLTQ KNIPQDTYVL CVLFKKDGPG PRNGAQYGAP FKEEDWSDEE  180
HRTDIPNTSN AAIFLHGHNA ETSPAVAPSH DSNKACVGGM ISESCVSDFP PATATATNSV  240
TAAHLTDAAN TPVSAPLLDP NSSASMAQTL QAPNDDDDIY AMLDLFVEED DYLRFCQTNN  300
NEARHEANVS APISLGEEVI FDDLPDFSSM HNNSIPRTPS YDLIENSELY LELQDLTTPL  360
APPHIWNVSD SYLTAPLAPT QLGNVSDSHL TAPFAPPQVG NGSDPFLSHQ GHFDFSAAAN  420
DDAYGFP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-43615615168Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC9667580.0KC966758.1 Brassica napus NAC transcription factor 82 (NAC82.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013611566.10.0PREDICTED: NAC domain-containing protein 82
RefseqXP_013611567.10.0PREDICTED: NAC domain-containing protein 82
SwissprotQ9FY820.0NAC82_ARATH; NAC domain-containing protein 82
TrEMBLA0A078G5470.0A0A078G547_BRANA; BnaC09g47170D protein
STRINGBra009379.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36922562
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G09330.41e-170NAC domain containing protein 82